LL-37 5MG
Chemical Information
- Molecular Formula: C₂₀₅H₃₄₀N₆₀O₅₃
- Molecular Weight: 4,493.3 g/mol
- Sequence: [LL-37, 37 aa]
- Description: Human cathelicidin antimicrobial peptide (37 amino acids)
Product Description LL-37 is a high-purity synthetic antimicrobial peptide supplied as a lyophilized white powder. This cathelicidin-derived peptide is designed for in vitro and analytical research applications only, supporting laboratory studies involving innate immunity, antimicrobial activity, wound healing, and inflammation modulation.
This material is provided strictly for qualified laboratory environments and is not for human, animal, or therapeutic use.
Product Designation This product uses an internal catalog designation for identification and differentiation. It is not marketed or represented as any approved pharmaceutical or therapeutic compound.
Research Applications In controlled laboratory settings, LL-37 is used for:
- Antimicrobial and antibacterial activity studies
- Innate immune response and host defense mechanism research
- Wound healing, angiogenesis, and tissue repair modeling
- Investigation of anti-inflammatory and immunomodulatory properties
- Biofilm disruption and membrane interaction studies
- Development and optimization of peptide-based screening assays
All applications are limited to non-human, non-clinical research models.
Storage and Handling
- Lyophilized form: Store at -20°C
- Reconstituted solution: Store at 2–8°C and use promptly
- Maintain aseptic techniques to preserve sterility and product integrity
Product Specifications
- Purity: ≥98% (HPLC Certified)
- Appearance: Lyophilized white powder
- Solubility: Soluble in standard laboratory buffers/solvents (may require slight acidification)
Important Compliance Notice This compound is FOR RESEARCH USE ONLY.
LL-37 is a synthetic human cathelicidin peptide used extensively in immunological and antimicrobial research. This research material is not an investigational drug product, has not been evaluated by the FDA for any use, and is not intended for clinical, diagnostic, or veterinary applications.
Misuse of this product is strictly prohibited and may violate applicable laws. By purchasing, the buyer confirms that this product will be used exclusively for legitimate in vitro research purposes in qualified laboratory settings.
The Peptide Co. – Premium Research Peptides for Scientific Excellence. All products are sold for research purposes only. Not for human consumption.




